PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G1244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 357aa    MW: 39716.8 Da    PI: 7.7126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G1244genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l ++++ +G+g+W+t ++  g+ R++k+c++rw +yl
      Gh_A12G1244 14 KGPWTPEEDLKLTNYIQSHGPGNWRTLPKNAGLERCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.52.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Gh_A12G1244  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.42961IPR017930Myb domain
SuperFamilySSF466891.27E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
CDDcd001675.06E-111661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001672.21E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRAPCCDKT GLKKGPWTPE EDLKLTNYIQ SHGPGNWRTL PKNAGLERCG KSCRLRWANY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRNG  120
IDPVTHAPRL DMLDLSSILT STLCNQSLLN ASNLLGAQPL LNPQLLRLAN TLLSLKQENP  180
DILVQYLHKN QLSNSQQHLV PSSLQPSQLQ VQSTIQNDST CTTSTPIPST WALNQIELMQ  240
NNATGISSNM KSFSCPDTQE TLTSTLTNAC ASLPKYVHCS PNPTDPFTSE NSNVQSIGGS  300
QMFSFDSVRS TPIRSPSPLN SPSTFINSSS SVDDERESFS SLLKFEIPDS LDISDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-30121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-30121162105C-Myb DNA-Binding Domain
1msf_C7e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438147.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0D2PVH40.0A0A0D2PVH4_G
STRINGPOPTR_0019s14070.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.18e-99MYB-like 102